پپتید شبه گلوکاگون ۲

از ویکی‌پدیا، دانشنامهٔ آزاد
پرش به ناوبری پرش به جستجو

پپتید شبه گلوکاگون ۲ (انگلیسی: Glucagon-like peptide-2) یک پپتید ۳۳ آمینواسیدی است که توالی آنها در انسان به‌صورت HADGSFSDEMNTILDNLAARDFINWLIQTKITD (اسید آمینه پروتئین‌زا را ببینید).

این پروتئین در «سلول‌های ال» در دستگاه درون‌ریز روده‌ها و نرون‌های دستگاه عصبی مرکزی ساخته می‌شود.

این مولکول پروتئینی و آنالوگ‌های آن ممکن است در درمان سندرم روده کوتاه، بیماری کرون و پوکی استخوان و همچنین در درمان کمکی سرطان در جریان شیمی‌درمانی بکار آیند.

منابع[ویرایش]